PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0225s0120.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 508aa    MW: 56899 Da    PI: 6.7566
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0225s0120.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3551.5e-178703498
                            SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                      B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                            ++l+ +d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F   + +++el+v+v+r
  SapurV1A.0225s0120.2.p  8 QELVATDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFL--RGENGELCVGVRR 70
                            47999*********************************************..449999*****98 PP

2Auxin_resp106.43.2e-3596178183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha++t++ F+v+Y+Pr+s+seF+v+++k+++  + k+svGmRfkm+fe+e+++err+sGt+vg+ d  ++ W +S WrsLk
  SapurV1A.0225s0120.2.p  96 ASHAIATGTLFSVFYKPRTSRSEFIVSLNKYLEVRNYKLSVGMRFKMRFEGEEVPERRFSGTIVGIGDNISSGWADSDWRSLK 178
                             789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.6E-26185IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.829172IPR003340B3 DNA binding domain
SuperFamilySSF1019365.62E-24199IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0034172IPR003340B3 DNA binding domain
CDDcd100172.06E-14870No hitNo description
PfamPF023625.5E-15870IPR003340B3 DNA binding domain
PfamPF065073.6E-3396178IPR010525Auxin response factor
PfamPF023095.9E-7373417IPR033389AUX/IAA domain
PROSITE profilePS5174526.411381474IPR000270PB1 domain
SuperFamilySSF542772.84E-9384458No hitNo description
PfamPF023093.6E-6425471IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MSQQPPWQEL VATDLHGNEW HFRHIFRGQP RRHLLTTGWS VFVSSKKLVA GDAFIFLRGE  60
NGELCVGVRR LMRQQMSMPS SVISSQSMHL GVLATASHAI ATGTLFSVFY KPRTSRSEFI  120
VSLNKYLEVR NYKLSVGMRF KMRFEGEEVP ERRFSGTIVG IGDNISSGWA DSDWRSLKVQ  180
WDEPSSIMRP ERVSHWELEP LVATTPLNSQ PVQRNKRPRP SVLPSPTTDI TSLGKWKSVA  240
ESSALSYGDS QHGRDLYPSI GFSTIAKANS LGFHGNSQVA SVSHNSMYRH NRVESVTDSF  300
ASVVNKDYRE RRQGTGIGYR LFGIQLVDNS NTEETSPINA MSGTMVNDHP VLSLEAESDQ  360
HSEPEKSCLR SPQELQSRQI RSCTKVHMQG VAVGRAVDLT QFEGYEDLMR KLEEMFDIEG  420
ELSGSTKKWE VVYTDNEDDM MKVGDDPWNE FCSMVKKIFI YTSEEVKRLS PKIKLLADEE  480
VKGVGNNADA DAAVNTEDRS STIGPGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldx_B1e-1211201155355Auxin response factor 1
4ldx_A1e-1211201155355Auxin response factor 1
4ldw_B1e-1211201155355Auxin response factor 1
4ldw_A1e-1211201155355Auxin response factor 1
4ldv_A1e-1211201155355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1215219KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM1130350.0KM113035.1 Populus davidiana x Populus alba var. pyramidalis auxin response factor 1 family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028402.10.0PREDICTED: auxin response factor 1
RefseqXP_011028403.10.0PREDICTED: auxin response factor 1
RefseqXP_011028404.10.0PREDICTED: auxin response factor 1
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLB9N0I30.0B9N0I3_POPTR; Auxin response factor
STRINGPOPTR_0003s00890.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.30.0auxin response factor 1